PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 205aa    MW: 22866.2 Da    PI: 7.2923
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14333.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.51.6e-31110166158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep++VNaKQy++Il+RRq+Rak+e+ekk  +++rkpylheSRh hAlrR+Rg+gGrF
  KHN14333.1 110 EEPVFVNAKQYHGILRRRQSRAKAESEKKA-ARNRKPYLHESRHLHALRRARGCGGRF 166
                 69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.0E-35108169IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.416109169IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.2E-27111166IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23112134IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860114134IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23143166IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MTTSTRDISD NEADEQQQSE PQMQHLSANG ISHAGIGTQN VQYATPPQLG TGHAVVPPTY  60
PYPDPYYRSI FAPYDAQTYP PQPYGGNPMV HLQLMGIQQA GVPLPTDTVE EPVFVNAKQY  120
HGILRRRQSR AKAESEKKAA RNRKPYLHES RHLHALRRAR GCGGRFLNSK KDENQQDEVA  180
STDESQSNIN LNSDKNELAP SDRTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20109174166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546259.11e-152PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_003546258.11e-152PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP19e-68NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0B2Q2Z61e-152A0A0B2Q2Z6_GLYSO; Nuclear transcription factor Y subunit A-7
TrEMBLI1MG331e-152I1MG33_SOYBN; Uncharacterized protein
STRINGGLYMA15G13660.11e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53793355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-50nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]